Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 1255aa    MW: 140750 Da    PI: 6.7058
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lLl+cAeav++++ + a +lL++++++as +gd+ qRla++f ++L+ar+++++++l + +++++ s   + e ++a++l 234 TLLLHCAEAVAANNRTVAGELLKQIKQNASATGDARQRLAQCFSKGLEARVLGTGNQLWNLVTAERPS---VLELAKAYRL 311
                                   68********************************************************9988888887...9********* PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleet 161
                                      ++ + k++++   ++I++a+ g++rvH++D+++ +G++W+ L++ +a +R++g ++l+iT+++ ++s   s++ +ee 312 SMAACCFSKVAFIFSIKTIMDAIVGKSRVHVVDYGMHYGFHWAELIRLMAkDRDGGRAELKITAIVCSRSLfwSAQGIEEQ 392
                                   **************************************************8899************988779********* PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvv 240
                                   g+rL+k A ++g++f+f+ ++a+++e++++++L++++gE+l+Vn +++ ++l+des+  ++  +rd vL+ +++++P+v++ 393 GRRLSKCAGKFGLSFKFHSITATKWECVRIQDLNTDTGEVLIVNDMYNFMTLMDESMLFDEpsPRDIVLSNIRNMRPDVFI 473
                                   ********************************************************98776669***************99 PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                    +  +++ n++sFl rf eal yy+alfd ++a++pr+se r ++E+ellg+++ nvvaceg++   r e++++ ++r ++ 474 QSIVNSS-NGGSFLSRFREALFYYTALFDVFDATMPRQSESRLVLEQELLGNHLLNVVACEGRDLMGRPEKYRQCQARNQR 553
                                   8877654.899********************************************************************** PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                                   aG+k++pl+  ++k +k  ++++++d +++ e+ ++l++gW+ 554 AGLKQLPLKPGIVKGIKESVKTHHKD-FMLGEDGQWLLQGWMA 595
                                   ************************77.**************85 PP

                          GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80  
                                      lLl+cAe v ++ ++ a++lL++++ +asp+gd++qRla++f+eAL++rla+++ + +      + + ++ ++ l+a  879 HALLLRCAETVMDDGQRGARELLEKIKRHASPTGDATQRLAHCFAEALETRLAGMGAHRS------SFTIHQPVRFLKA 951 
                                    579***************************************************544444......3333346789*** PP

                          GRAS   81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skee 157 
                                    + l+  ++ + k++++ +N+ I++a++g +r+Hi+D+++ +G+QWp Ll+ La+R++gpp++ iTg++  ++   s++  952 YPLYIATCCFNKVAFMFCNRSIYQAAAGRSRLHIVDYGVCHGFQWPVLLRWLAAREGGPPQVTITGIVLTKHWyrSSDH 1030
                                    *********************************************************************666699**** PP

                          GRAS  158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvksl 234 
                                    +eetg+rL++ A+elgvpf+f++++a ++++++le+L+v+p+ alaVn+ ++l+ + d+sv ++   +rd vL  ++++ 1031 IEETGHRLSNCARELGVPFKFQAIMAAKWDAVHLEDLSVDPDAALAVNSLFSLEMMDDDSVVVDRasPRDVVLGNIRRM 1109
                                    *********************************************************99987766669*********** PP

                          GRAS  235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetle 313 
                                    +P v+++   +  + ++sFl+rf e+l +ysa+fd+l+a++pr se+r ++E  +lg  + n++aceg++r+ r e+++ 1110 RPAVFTIGIVNGLC-GSSFLTRFRETLVHYSAMFDMLDATMPRGSEQRLVLESDMLGSFALNIIACEGQDRTDRFESYK 1187
                                    **********9988.779************************************************************* PP

                          GRAS  314 kWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                                    +W++r+++a ++++pl+ ++   +  ++++ + + + ++e++ +l++gWk+r L++ S W 1188 QWHMRMQRAELRQLPLDRDIIGAVTDMVKQQYHKDFVIHEDRRWLLQGWKGRILFAHSTW 1247
                                    *****************************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.328206586IPR005202Transcription factor GRAS
PfamPF035146.5E-82234595IPR005202Transcription factor GRAS
PROSITE profilePS5098553.5348521228IPR005202Transcription factor GRAS
PfamPF035147.6E-958791247IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1255 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3723612478374GRAS family transcription factor containing p
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-106GRAS family protein